PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000284G0590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 377aa    MW: 39312.1 Da    PI: 6.2843
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000284G0590genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.66e-17253287135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C t  Tp+WR gp g+ktLCnaCG++y++ +l
  PH01000284G0590 253 CLHCETDRTPQWRTGPMGPKTLCNACGVRYKSGRL 287
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.2E-698338IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.255247283IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.1E-14247284IPR013088Zinc finger, NHR/GATA-type
SMARTSM004013.6E-17247297IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.04E-15249310No hitNo description
CDDcd002021.07E-13252303No hitNo description
PROSITE patternPS003440253278IPR000679Zinc finger, GATA-type
PfamPF003207.8E-15253287IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MEATAEYNVH GYYAGSGRDK KGAACGDHFV VDDLLVLPYD DEEEGEGEAA GAGTLAGFGN  60
ASADSSTVTA LDSCSNSFSG LADGDFSGEL CEPYDQLAEL EWLSNYMGEG VDAFASEDLQ  120
KLQLISGIPS GGFSSARVPP APAAPAAAAT SAAQPGIFLP EAPVPAKARS KRSRAAPGNW  180
SSRLVVLPPP PASPPSPASM AISPAESGVS AQAFPVKKLS NPAKKKDALP QAHPSRASAP  240
SGCSAAAGEG MRCLHCETDR TPQWRTGPMG PKTLCNACGV RYKSGRLVPE YRPAASPTFM  300
VSKHSNSHRK VLELRRQKEV EQQPLQHQLH VAGGGVGSLM HMQSPLLFDG PSASPIVGGD  360
DFLIHHRLGT DFRQLI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969927.11e-166PREDICTED: GATA transcription factor 12
TrEMBLA0A0D9V5J81e-178A0A0D9V5J8_9ORYZ; Uncharacterized protein
STRINGORGLA01G0250200.11e-166(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-60GATA transcription factor 12